Brand: | Abnova |
Reference: | H00007690-M07A |
Product name: | ZNF131 monoclonal antibody (M07A), clone 5F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF131. |
Clone: | 5F1 |
Isotype: | IgG2a Kappa |
Gene id: | 7690 |
Gene name: | ZNF131 |
Gene alias: | pHZ-10 |
Gene description: | zinc finger protein 131 |
Genbank accession: | BC035875 |
Immunogen: | ZNF131 (AAH35875, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHT |
Protein accession: | AAH35875 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |