ZNF131 monoclonal antibody (M07), clone 5F1 View larger

ZNF131 monoclonal antibody (M07), clone 5F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF131 monoclonal antibody (M07), clone 5F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ZNF131 monoclonal antibody (M07), clone 5F1

Brand: Abnova
Reference: H00007690-M07
Product name: ZNF131 monoclonal antibody (M07), clone 5F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF131.
Clone: 5F1
Isotype: IgG2a Kappa
Gene id: 7690
Gene name: ZNF131
Gene alias: pHZ-10
Gene description: zinc finger protein 131
Genbank accession: BC035875
Immunogen: ZNF131 (AAH35875, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHT
Protein accession: AAH35875
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007690-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007690-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF131 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Kaiso Regulates Znf131-Mediated Transcriptional Activation.Donaldson NS, Nordgaard CL, Pierre CC, Kelly KF, Robinson S, Swystun L, Henriquez R, Graham M, Daniel JM.
Exp Cell Res. 2010 Mar 18. [Epub ahead of print]

Reviews

Buy ZNF131 monoclonal antibody (M07), clone 5F1 now

Add to cart