MKRN3 monoclonal antibody (M01), clone 2E10 View larger

MKRN3 monoclonal antibody (M01), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MKRN3 monoclonal antibody (M01), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about MKRN3 monoclonal antibody (M01), clone 2E10

Brand: Abnova
Reference: H00007681-M01
Product name: MKRN3 monoclonal antibody (M01), clone 2E10
Product description: Mouse monoclonal antibody raised against a partial recombinant MKRN3.
Clone: 2E10
Isotype: IgG2b Kappa
Gene id: 7681
Gene name: MKRN3
Gene alias: D15S9|MGC88288|RNF63|ZFP127|ZNF127
Gene description: makorin ring finger protein 3
Genbank accession: NM_005664
Immunogen: MKRN3 (NP_005655, 437 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL
Protein accession: NP_005655
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007681-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MKRN3 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy MKRN3 monoclonal antibody (M01), clone 2E10 now

Add to cart