ZNF124 monoclonal antibody (M01), clone 4G4 View larger

ZNF124 monoclonal antibody (M01), clone 4G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF124 monoclonal antibody (M01), clone 4G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF124 monoclonal antibody (M01), clone 4G4

Brand: Abnova
Reference: H00007678-M01
Product name: ZNF124 monoclonal antibody (M01), clone 4G4
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF124.
Clone: 4G4
Isotype: IgG1 Kappa
Gene id: 7678
Gene name: ZNF124
Gene alias: HZF-16|HZF16|MGC117046
Gene description: zinc finger protein 124
Genbank accession: NM_003431
Immunogen: ZNF124 (NP_003422, 121 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CGKAFSRSSHLRDHERTHTGEKPYECKHCGKAFRYSNCLHYHERTHTGEKPYVCMECGKAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKHEKTHIAQKPYV
Protein accession: NP_003422
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007678-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007678-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF124 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF124 monoclonal antibody (M01), clone 4G4 now

Add to cart