ZNF85 monoclonal antibody (M06), clone 3C1 View larger

ZNF85 monoclonal antibody (M06), clone 3C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF85 monoclonal antibody (M06), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ZNF85 monoclonal antibody (M06), clone 3C1

Brand: Abnova
Reference: H00007639-M06
Product name: ZNF85 monoclonal antibody (M06), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF85.
Clone: 3C1
Isotype: IgG2a Kappa
Gene id: 7639
Gene name: ZNF85
Gene alias: HPF4|HTF1|MGC78566
Gene description: zinc finger protein 85
Genbank accession: NM_003429
Immunogen: ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT
Protein accession: NP_003420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ZNF85 monoclonal antibody (M06), clone 3C1 now

Add to cart