ZNF85 monoclonal antibody (M04), clone 4D12 View larger

ZNF85 monoclonal antibody (M04), clone 4D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF85 monoclonal antibody (M04), clone 4D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZNF85 monoclonal antibody (M04), clone 4D12

Brand: Abnova
Reference: H00007639-M04
Product name: ZNF85 monoclonal antibody (M04), clone 4D12
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF85.
Clone: 4D12
Isotype: IgG2b Kappa
Gene id: 7639
Gene name: ZNF85
Gene alias: HPF4|HTF1|MGC78566
Gene description: zinc finger protein 85
Genbank accession: NM_003429
Immunogen: ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT
Protein accession: NP_003420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007639-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF85 monoclonal antibody (M04), clone 4D12 now

Add to cart