Brand: | Abnova |
Reference: | H00007639-M04 |
Product name: | ZNF85 monoclonal antibody (M04), clone 4D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF85. |
Clone: | 4D12 |
Isotype: | IgG2b Kappa |
Gene id: | 7639 |
Gene name: | ZNF85 |
Gene alias: | HPF4|HTF1|MGC78566 |
Gene description: | zinc finger protein 85 |
Genbank accession: | NM_003429 |
Immunogen: | ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT |
Protein accession: | NP_003420 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |