ZNF85 monoclonal antibody (M02), clone 2G9 View larger

ZNF85 monoclonal antibody (M02), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF85 monoclonal antibody (M02), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA

More info about ZNF85 monoclonal antibody (M02), clone 2G9

Brand: Abnova
Reference: H00007639-M02
Product name: ZNF85 monoclonal antibody (M02), clone 2G9
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF85.
Clone: 2G9
Isotype: IgG2b Kappa
Gene id: 7639
Gene name: ZNF85
Gene alias: HPF4|HTF1|MGC78566
Gene description: zinc finger protein 85
Genbank accession: NM_003429
Immunogen: ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT
Protein accession: NP_003420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007639-M02-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ZNF85 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,ELISA
Shipping condition: Dry Ice

Reviews

Buy ZNF85 monoclonal antibody (M02), clone 2G9 now

Add to cart