ZNF79 monoclonal antibody (M03), clone 3D12 View larger

ZNF79 monoclonal antibody (M03), clone 3D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF79 monoclonal antibody (M03), clone 3D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNF79 monoclonal antibody (M03), clone 3D12

Brand: Abnova
Reference: H00007633-M03
Product name: ZNF79 monoclonal antibody (M03), clone 3D12
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF79.
Clone: 3D12
Isotype: IgG2a Kappa
Gene id: 7633
Gene name: ZNF79
Gene alias: pT7
Gene description: zinc finger protein 79
Genbank accession: NM_007135
Immunogen: ZNF79 (NP_009066.1, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WRCLVSTPRDRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSF
Protein accession: NP_009066.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007633-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007633-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF79 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF79 monoclonal antibody (M03), clone 3D12 now

Add to cart