ZNF70 monoclonal antibody (M01), clone 1D8 View larger

ZNF70 monoclonal antibody (M01), clone 1D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF70 monoclonal antibody (M01), clone 1D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF70 monoclonal antibody (M01), clone 1D8

Brand: Abnova
Reference: H00007621-M01
Product name: ZNF70 monoclonal antibody (M01), clone 1D8
Product description: Mouse monoclonal antibody raised against a full-length recombinant ZNF70.
Clone: 1D8
Isotype: IgG2a Kappa
Gene id: 7621
Gene name: ZNF70
Gene alias: Cos17|MGC48959
Gene description: zinc finger protein 70
Genbank accession: BC040161
Immunogen: ZNF70 (AAH40161, 1 a.a. ~ 446 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
Protein accession: AAH40161
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007621-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (74.8 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007621-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF70 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF70 monoclonal antibody (M01), clone 1D8 now

Add to cart