ZNF69 monoclonal antibody (M08), clone 1E3 View larger

ZNF69 monoclonal antibody (M08), clone 1E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF69 monoclonal antibody (M08), clone 1E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ZNF69 monoclonal antibody (M08), clone 1E3

Brand: Abnova
Reference: H00007620-M08
Product name: ZNF69 monoclonal antibody (M08), clone 1E3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF69.
Clone: 1E3
Isotype: IgG2a Kappa
Gene id: 7620
Gene name: ZNF69
Gene alias: Cos5|MGC59928
Gene description: zinc finger protein 69
Genbank accession: NM_021915
Immunogen: ZNF69 (NP_068734.1, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIK
Protein accession: NP_068734.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007620-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF69 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ZNF69 monoclonal antibody (M08), clone 1E3 now

Add to cart