Brand: | Abnova |
Reference: | H00007620-M08 |
Product name: | ZNF69 monoclonal antibody (M08), clone 1E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF69. |
Clone: | 1E3 |
Isotype: | IgG2a Kappa |
Gene id: | 7620 |
Gene name: | ZNF69 |
Gene alias: | Cos5|MGC59928 |
Gene description: | zinc finger protein 69 |
Genbank accession: | NM_021915 |
Immunogen: | ZNF69 (NP_068734.1, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIK |
Protein accession: | NP_068734.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNF69 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |