ZBTB25 monoclonal antibody (M06), clone 3F8 View larger

ZBTB25 monoclonal antibody (M06), clone 3F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB25 monoclonal antibody (M06), clone 3F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ZBTB25 monoclonal antibody (M06), clone 3F8

Brand: Abnova
Reference: H00007597-M06
Product name: ZBTB25 monoclonal antibody (M06), clone 3F8
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBTB25.
Clone: 3F8
Isotype: IgG2a Kappa
Gene id: 7597
Gene name: ZBTB25
Gene alias: KUP|ZNF46
Gene description: zinc finger and BTB domain containing 25
Genbank accession: NM_006977
Immunogen: ZBTB25 (NP_008908.2, 331 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE
Protein accession: NP_008908.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007597-M06-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZBTB25 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ZBTB25 monoclonal antibody (M06), clone 3F8 now

Add to cart