ZBTB25 monoclonal antibody (M05A), clone 2B8 View larger

ZBTB25 monoclonal antibody (M05A), clone 2B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB25 monoclonal antibody (M05A), clone 2B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ZBTB25 monoclonal antibody (M05A), clone 2B8

Brand: Abnova
Reference: H00007597-M05A
Product name: ZBTB25 monoclonal antibody (M05A), clone 2B8
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBTB25.
Clone: 2B8
Isotype: IgG2a Kappa
Gene id: 7597
Gene name: ZBTB25
Gene alias: KUP|ZNF46
Gene description: zinc finger and BTB domain containing 25
Genbank accession: NM_006977
Immunogen: ZBTB25 (NP_008908.2, 331 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE
Protein accession: NP_008908.2
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007597-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007597-M05A-13-15-1.jpg
Application image note: Western Blot analysis of ZBTB25 expression in transfected 293T cell line by ZBTB25 monoclonal antibody (M05A), clone 2B8.

Lane 1: ZBTB25 transfected lysate (Predicted MW: 49 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZBTB25 monoclonal antibody (M05A), clone 2B8 now

Add to cart