ZNF41 monoclonal antibody (M07), clone 2F3 View larger

ZNF41 monoclonal antibody (M07), clone 2F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF41 monoclonal antibody (M07), clone 2F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ZNF41 monoclonal antibody (M07), clone 2F3

Brand: Abnova
Reference: H00007592-M07
Product name: ZNF41 monoclonal antibody (M07), clone 2F3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF41.
Clone: 2F3
Isotype: IgG1 Kappa
Gene id: 7592
Gene name: ZNF41
Gene alias: MGC8941|MRX89
Gene description: zinc finger protein 41
Genbank accession: NM_007130
Immunogen: ZNF41 (NP_009061, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV*
Protein accession: NP_009061
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007592-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007592-M07-13-15-1.jpg
Application image note: Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M07), clone 2F3.

Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF41 monoclonal antibody (M07), clone 2F3 now

Add to cart