Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007592-M05 |
Product name: | ZNF41 monoclonal antibody (M05), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF41. |
Clone: | 1E1 |
Isotype: | IgG1 Kappa |
Gene id: | 7592 |
Gene name: | ZNF41 |
Gene alias: | MGC8941|MRX89 |
Gene description: | zinc finger protein 41 |
Genbank accession: | NM_007130 |
Immunogen: | ZNF41 (NP_009061, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV* |
Protein accession: | NP_009061 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M05), clone 1E1. Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |