ZSCAN21 monoclonal antibody (M18), clone 2A8 View larger

ZSCAN21 monoclonal antibody (M18), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZSCAN21 monoclonal antibody (M18), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ZSCAN21 monoclonal antibody (M18), clone 2A8

Brand: Abnova
Reference: H00007589-M18
Product name: ZSCAN21 monoclonal antibody (M18), clone 2A8
Product description: Mouse monoclonal antibody raised against a full length recombinant ZSCAN21.
Clone: 2A8
Isotype: IgG2a Kappa
Gene id: 7589
Gene name: ZSCAN21
Gene alias: DKFZp434L134|DKFZp686H10254|NY-REN-21|ZNF38|Zipro1
Gene description: zinc finger and SCAN domain containing 21
Genbank accession: NM_145914
Immunogen: ZSCAN21 (NP_666019, 136 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI
Protein accession: NP_666019
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007589-M18-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007589-M18-13-15-1.jpg
Application image note: Western Blot analysis of ZSCAN21 expression in transfected 293T cell line by ZSCAN21 monoclonal antibody (M18), clone 2A8.

Lane 1: ZSCAN21 transfected lysate(50.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZSCAN21 monoclonal antibody (M18), clone 2A8 now

Add to cart