ZNF35 purified MaxPab mouse polyclonal antibody (B01P) View larger

ZNF35 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF35 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about ZNF35 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007584-B01P
Product name: ZNF35 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ZNF35 protein.
Gene id: 7584
Gene name: ZNF35
Gene alias: HF.10|HF10|Zfp105
Gene description: zinc finger protein 35
Genbank accession: BC013597
Immunogen: ZNF35 (AAH13597, 1 a.a. ~ 519 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALAPWGPVKVKKEEEEEENFPGQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGAETKNLQLLVPKTEICEEAEKPLIISERIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVNDCHLPESFKEEENQKCKKSGGKYSLNSGAVKNPKTQLGQKPFTCSVCGKGFSQSANLVVHQRIHTGEKPFECHECGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIHSLEKTFKCNECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEKPFACNDCGKAFAQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDCSECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECGKAFRQRSSLTVHQRTHTGEKPYECEKCGAAFISNSHLMRHHRTHLVE
Protein accession: AAH13597
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007584-B01P-2-A5-1.jpg
Application image note: ZNF35 MaxPab polyclonal antibody. Western Blot analysis of ZNF35 expression in human ovarian cancer.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF35 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart