Brand: | Abnova |
Reference: | H00007574-A01 |
Product name: | ZNF26 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ZNF26. |
Gene id: | 7574 |
Gene name: | ZNF26 |
Gene alias: | FLJ20755|KOX20 |
Gene description: | zinc finger protein 26 |
Genbank accession: | NM_019591 |
Immunogen: | ZNF26 (NP_062537, 445 a.a. ~ 533 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK |
Protein accession: | NP_062537 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |