ZNF23 monoclonal antibody (M02), clone 2D3 View larger

ZNF23 monoclonal antibody (M02), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF23 monoclonal antibody (M02), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF23 monoclonal antibody (M02), clone 2D3

Brand: Abnova
Reference: H00007571-M02
Product name: ZNF23 monoclonal antibody (M02), clone 2D3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF23.
Clone: 2D3
Isotype: IgG2a Kappa
Gene id: 7571
Gene name: ZNF23
Gene alias: KOX16|MGC57283|ZNF359|ZNF612|Zfp612
Gene description: zinc finger protein 23 (KOX 16)
Genbank accession: NM_145911
Immunogen: ZNF23 (NP_666016.1, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP
Protein accession: NP_666016.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007571-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007571-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF23 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF23 monoclonal antibody (M02), clone 2D3 now

Add to cart