ZNF21 monoclonal antibody (M03), clone 6D11 View larger

ZNF21 monoclonal antibody (M03), clone 6D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF21 monoclonal antibody (M03), clone 6D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about ZNF21 monoclonal antibody (M03), clone 6D11

Brand: Abnova
Reference: H00007569-M03
Product name: ZNF21 monoclonal antibody (M03), clone 6D11
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF21.
Clone: 6D11
Isotype: IgG1 Kappa
Gene id: 7569
Gene name: ZNF182
Gene alias: HHZ150|KOX14|MGC125383|MGC131713|ZNF21|Zfp182
Gene description: zinc finger protein 182
Genbank accession: NM_006962
Immunogen: ZNF21 (NP_008893, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKL
Protein accession: NP_008893
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007569-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007569-M03-1-25-1.jpg
Application image note: ZNF21 monoclonal antibody (M03), clone 6D11 Western Blot analysis of ZNF21 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF21 monoclonal antibody (M03), clone 6D11 now

Add to cart