ZNF18 monoclonal antibody (M01), clone 2A4 View larger

ZNF18 monoclonal antibody (M01), clone 2A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF18 monoclonal antibody (M01), clone 2A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF18 monoclonal antibody (M01), clone 2A4

Brand: Abnova
Reference: H00007566-M01
Product name: ZNF18 monoclonal antibody (M01), clone 2A4
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF18.
Clone: 2A4
Isotype: IgG1 Kappa
Gene id: 7566
Gene name: ZNF18
Gene alias: HDSG1|KOX11|ZKSCAN6|ZNF535|Zfp535
Gene description: zinc finger protein 18
Genbank accession: NM_144680
Immunogen: ZNF18 (NP_653281, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG
Protein accession: NP_653281
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007566-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007566-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody (M01), clone 2A4.

Lane 1: ZNF18 transfected lysate(62.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF18 monoclonal antibody (M01), clone 2A4 now

Add to cart