ZNF12 monoclonal antibody (M04), clone 8H7 View larger

ZNF12 monoclonal antibody (M04), clone 8H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF12 monoclonal antibody (M04), clone 8H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNF12 monoclonal antibody (M04), clone 8H7

Brand: Abnova
Reference: H00007559-M04
Product name: ZNF12 monoclonal antibody (M04), clone 8H7
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF12.
Clone: 8H7
Isotype: IgG2a Kappa
Gene id: 7559
Gene name: ZNF12
Gene alias: GIOT-3|HZF11|KOX3|ZNF325
Gene description: zinc finger protein 12
Genbank accession: NM_016265
Immunogen: ZNF12 (NP_057349, 69 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VEGEFLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISSDGSYARMKADECSGCGKSL
Protein accession: NP_057349
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007559-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007559-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF12 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF12 monoclonal antibody (M04), clone 8H7 now

Add to cart