ZNF7 monoclonal antibody (M04), clone 6F2 View larger

ZNF7 monoclonal antibody (M04), clone 6F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF7 monoclonal antibody (M04), clone 6F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ZNF7 monoclonal antibody (M04), clone 6F2

Brand: Abnova
Reference: H00007553-M04
Product name: ZNF7 monoclonal antibody (M04), clone 6F2
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF7.
Clone: 6F2
Isotype: IgG2b Kappa
Gene id: 7553
Gene name: ZNF7
Gene alias: FLJ38706|HF.16|KOX4|zf30
Gene description: zinc finger protein 7
Genbank accession: NM_003416
Immunogen: ZNF7 (NP_003407, 67 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTK
Protein accession: NP_003407
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007553-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007553-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ZNF7 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF7 monoclonal antibody (M04), clone 6F2 now

Add to cart