ZIC2 monoclonal antibody (M08), clone 3H7 View larger

ZIC2 monoclonal antibody (M08), clone 3H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZIC2 monoclonal antibody (M08), clone 3H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZIC2 monoclonal antibody (M08), clone 3H7

Brand: Abnova
Reference: H00007546-M08
Product name: ZIC2 monoclonal antibody (M08), clone 3H7
Product description: Mouse monoclonal antibody raised against a full length recombinant ZIC2.
Clone: 3H7
Isotype: IgG2a Kappa
Gene id: 7546
Gene name: ZIC2
Gene alias: HPE5
Gene description: Zic family member 2 (odd-paired homolog, Drosophila)
Genbank accession: NM_007129
Immunogen: ZIC2 (NP_009060, 130 a.a. ~ 220 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: APGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMN
Protein accession: NP_009060
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007546-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZIC2 monoclonal antibody (M08), clone 3H7 now

Add to cart