Brand: | Abnova |
Reference: | H00007546-M01 |
Product name: | ZIC2 monoclonal antibody (M01), clone 3C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZIC2. |
Clone: | 3C12 |
Isotype: | IgG2a Kappa |
Gene id: | 7546 |
Gene name: | ZIC2 |
Gene alias: | HPE5 |
Gene description: | Zic family member 2 (odd-paired homolog, Drosophila) |
Genbank accession: | NM_007129 |
Immunogen: | ZIC2 (NP_009060, 151 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPY |
Protein accession: | NP_009060 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.26 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |