ZIC2 monoclonal antibody (M01), clone 3C12 View larger

ZIC2 monoclonal antibody (M01), clone 3C12

H00007546-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZIC2 monoclonal antibody (M01), clone 3C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZIC2 monoclonal antibody (M01), clone 3C12

Brand: Abnova
Reference: H00007546-M01
Product name: ZIC2 monoclonal antibody (M01), clone 3C12
Product description: Mouse monoclonal antibody raised against a partial recombinant ZIC2.
Clone: 3C12
Isotype: IgG2a Kappa
Gene id: 7546
Gene name: ZIC2
Gene alias: HPE5
Gene description: Zic family member 2 (odd-paired homolog, Drosophila)
Genbank accession: NM_007129
Immunogen: ZIC2 (NP_009060, 151 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPY
Protein accession: NP_009060
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007546-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.26 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZIC2 monoclonal antibody (M01), clone 3C12 now

Add to cart