ZIC1 monoclonal antibody (M06), clone 4D2 View larger

ZIC1 monoclonal antibody (M06), clone 4D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZIC1 monoclonal antibody (M06), clone 4D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ZIC1 monoclonal antibody (M06), clone 4D2

Brand: Abnova
Reference: H00007545-M06
Product name: ZIC1 monoclonal antibody (M06), clone 4D2
Product description: Mouse monoclonal antibody raised against a full length recombinant ZIC1.
Clone: 4D2
Isotype: IgG2a Kappa
Gene id: 7545
Gene name: ZIC1
Gene alias: ZIC|ZNF201
Gene description: Zic family member 1 (odd-paired homolog, Drosophila)
Genbank accession: NM_003412
Immunogen: ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA
Protein accession: NP_003403
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007545-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007545-M06-1-1-1.jpg
Application image note: ZIC1 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ZIC1 expression in HeLa.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZIC1 monoclonal antibody (M06), clone 4D2 now

Add to cart