ZIC1 monoclonal antibody (M05A), clone 3C1 View larger

ZIC1 monoclonal antibody (M05A), clone 3C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZIC1 monoclonal antibody (M05A), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZIC1 monoclonal antibody (M05A), clone 3C1

Brand: Abnova
Reference: H00007545-M05A
Product name: ZIC1 monoclonal antibody (M05A), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZIC1.
Clone: 3C1
Isotype: IgG2a Kappa
Gene id: 7545
Gene name: ZIC1
Gene alias: ZIC|ZNF201
Gene description: Zic family member 1 (odd-paired homolog, Drosophila)
Genbank accession: NM_003412
Immunogen: ZIC1 (NP_003403, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN
Protein accession: NP_003403
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007545-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZIC1 monoclonal antibody (M05A), clone 3C1 now

Add to cart