ZFP161 monoclonal antibody (M01), clone 2F1 View larger

ZFP161 monoclonal antibody (M01), clone 2F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFP161 monoclonal antibody (M01), clone 2F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZFP161 monoclonal antibody (M01), clone 2F1

Brand: Abnova
Reference: H00007541-M01
Product name: ZFP161 monoclonal antibody (M01), clone 2F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZFP161.
Clone: 2F1
Isotype: IgG2a Kappa
Gene id: 7541
Gene name: ZFP161
Gene alias: MGC126126|ZBTB14|ZF5|ZNF478
Gene description: zinc finger protein 161 homolog (mouse)
Genbank accession: NM_003409
Immunogen: ZFP161 (NP_003400.2, 311 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP
Protein accession: NP_003400.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007541-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007541-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZFP161 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZFP161 monoclonal antibody (M01), clone 2F1 now

Add to cart