Brand: | Abnova |
Reference: | H00007541-M01 |
Product name: | ZFP161 monoclonal antibody (M01), clone 2F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZFP161. |
Clone: | 2F1 |
Isotype: | IgG2a Kappa |
Gene id: | 7541 |
Gene name: | ZFP161 |
Gene alias: | MGC126126|ZBTB14|ZF5|ZNF478 |
Gene description: | zinc finger protein 161 homolog (mouse) |
Genbank accession: | NM_003409 |
Immunogen: | ZFP161 (NP_003400.2, 311 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP |
Protein accession: | NP_003400.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZFP161 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |