ZFP36 (Human) Recombinant Protein (P01) View larger

ZFP36 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFP36 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ZFP36 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00007538-P01
Product name: ZFP36 (Human) Recombinant Protein (P01)
Product description: Human ZFP36 full-length ORF ( NP_003398.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 7538
Gene name: ZFP36
Gene alias: G0S24|GOS24|NUP475|RNF162A|TIS11|TTP
Gene description: zinc finger protein 36, C3H type, homolog (mouse)
Genbank accession: NM_003407.1
Immunogen sequence/protein sequence: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Protein accession: NP_003398.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00007538-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: RNA binding proteins regulate anabolic and catabolic gene expression in chondrocytes.McDermott BT, Ellis S, Bou-Gharios G, Clegg PD, Tew SR.
Osteoarthritis Cartilage. 2016 Feb 4. [Epub ahead of print]

Reviews

Buy ZFP36 (Human) Recombinant Protein (P01) now

Add to cart