Brand: | Abnova |
Reference: | H00007538-P01 |
Product name: | ZFP36 (Human) Recombinant Protein (P01) |
Product description: | Human ZFP36 full-length ORF ( NP_003398.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 7538 |
Gene name: | ZFP36 |
Gene alias: | G0S24|GOS24|NUP475|RNF162A|TIS11|TTP |
Gene description: | zinc finger protein 36, C3H type, homolog (mouse) |
Genbank accession: | NM_003407.1 |
Immunogen sequence/protein sequence: | MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE |
Protein accession: | NP_003398.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | RNA binding proteins regulate anabolic and catabolic gene expression in chondrocytes.McDermott BT, Ellis S, Bou-Gharios G, Clegg PD, Tew SR. Osteoarthritis Cartilage. 2016 Feb 4. [Epub ahead of print] |