SF1 monoclonal antibody (M01), clone 2E12 View larger

SF1 monoclonal antibody (M01), clone 2E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SF1 monoclonal antibody (M01), clone 2E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about SF1 monoclonal antibody (M01), clone 2E12

Brand: Abnova
Reference: H00007536-M01
Product name: SF1 monoclonal antibody (M01), clone 2E12
Product description: Mouse monoclonal antibody raised against a partial recombinant SF1.
Clone: 2E12
Isotype: IgG2a Kappa
Gene id: 7536
Gene name: SF1
Gene alias: D11S636|ZFM1|ZNF162
Gene description: splicing factor 1
Genbank accession: NM_004630
Immunogen: SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH
Protein accession: NP_004621
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007536-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00007536-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SF1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SF1 monoclonal antibody (M01), clone 2E12 now

Add to cart