YWHAZ monoclonal antibody (M12), clone 5E8 View larger

YWHAZ monoclonal antibody (M12), clone 5E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YWHAZ monoclonal antibody (M12), clone 5E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about YWHAZ monoclonal antibody (M12), clone 5E8

Brand: Abnova
Reference: H00007534-M12
Product name: YWHAZ monoclonal antibody (M12), clone 5E8
Product description: Mouse monoclonal antibody raised against a full-length recombinant YWHAZ.
Clone: 5E8
Isotype: IgG2a Kappa
Gene id: 7534
Gene name: YWHAZ
Gene alias: KCIP-1|MGC111427|MGC126532|MGC138156
Gene description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
Genbank accession: NM_003406.2
Immunogen: YWHAZ (NP_003397.1, 1 a.a. ~ 245 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Protein accession: NP_003397.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007534-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (54.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007534-M12-13-15-1.jpg
Application image note: Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M12), clone 5E8.

Lane 1: YWHAZ transfected lysate (Predicted MW: 27.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy YWHAZ monoclonal antibody (M12), clone 5E8 now

Add to cart