YWHAH monoclonal antibody (M07), clone 1C2 View larger

YWHAH monoclonal antibody (M07), clone 1C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YWHAH monoclonal antibody (M07), clone 1C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about YWHAH monoclonal antibody (M07), clone 1C2

Brand: Abnova
Reference: H00007533-M07
Product name: YWHAH monoclonal antibody (M07), clone 1C2
Product description: Mouse monoclonal antibody raised against a partial recombinant YWHAH.
Clone: 1C2
Isotype: IgG1 Kappa
Gene id: 7533
Gene name: YWHAH
Gene alias: YWHA1
Gene description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Genbank accession: BC003047
Immunogen: YWHAH (AAH03047, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHP
Protein accession: AAH03047
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007533-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YWHAH monoclonal antibody (M07), clone 1C2 now

Add to cart