YWHAG monoclonal antibody (M03), clone 1B4 View larger

YWHAG monoclonal antibody (M03), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YWHAG monoclonal antibody (M03), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about YWHAG monoclonal antibody (M03), clone 1B4

Brand: Abnova
Reference: H00007532-M03
Product name: YWHAG monoclonal antibody (M03), clone 1B4
Product description: Mouse monoclonal antibody raised against a full-length recombinant YWHAG.
Clone: 1B4
Isotype: IgG2a Kappa
Gene id: 7532
Gene name: YWHAG
Gene alias: 14-3-3GAMMA
Gene description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Genbank accession: BC020963
Immunogen: YWHAG (AAH20963, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMRPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Protein accession: AAH20963
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007532-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.91 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007532-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to YWHAG on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YWHAG monoclonal antibody (M03), clone 1B4 now

Add to cart