Brand: | Abnova |
Reference: | H00007532-M02 |
Product name: | YWHAG monoclonal antibody (M02), clone 6A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant YWHAG. |
Clone: | 6A10 |
Isotype: | IgG2b Kappa |
Gene id: | 7532 |
Gene name: | YWHAG |
Gene alias: | 14-3-3GAMMA |
Gene description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide |
Genbank accession: | NM_012479 |
Immunogen: | YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH |
Protein accession: | NP_036611 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | YWHAG monoclonal antibody (M02), clone 6A10 Western Blot analysis of YWHAG expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |