YWHAG monoclonal antibody (M02), clone 6A10 View larger

YWHAG monoclonal antibody (M02), clone 6A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YWHAG monoclonal antibody (M02), clone 6A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about YWHAG monoclonal antibody (M02), clone 6A10

Brand: Abnova
Reference: H00007532-M02
Product name: YWHAG monoclonal antibody (M02), clone 6A10
Product description: Mouse monoclonal antibody raised against a partial recombinant YWHAG.
Clone: 6A10
Isotype: IgG2b Kappa
Gene id: 7532
Gene name: YWHAG
Gene alias: 14-3-3GAMMA
Gene description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Genbank accession: NM_012479
Immunogen: YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH
Protein accession: NP_036611
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007532-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00007532-M02-1-9-1.jpg
Application image note: YWHAG monoclonal antibody (M02), clone 6A10 Western Blot analysis of YWHAG expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YWHAG monoclonal antibody (M02), clone 6A10 now

Add to cart