YWHAG monoclonal antibody (M01), clone 3G3 View larger

YWHAG monoclonal antibody (M01), clone 3G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YWHAG monoclonal antibody (M01), clone 3G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about YWHAG monoclonal antibody (M01), clone 3G3

Brand: Abnova
Reference: H00007532-M01
Product name: YWHAG monoclonal antibody (M01), clone 3G3
Product description: Mouse monoclonal antibody raised against a partial recombinant YWHAG.
Clone: 3G3
Isotype: IgG2a lambda
Gene id: 7532
Gene name: YWHAG
Gene alias: 14-3-3GAMMA
Gene description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Genbank accession: NM_012479
Immunogen: YWHAG (NP_036611, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ
Protein accession: NP_036611
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007532-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged YWHAG is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy YWHAG monoclonal antibody (M01), clone 3G3 now

Add to cart