YWHAB monoclonal antibody (M02A), clone 1F11 View larger

YWHAB monoclonal antibody (M02A), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YWHAB monoclonal antibody (M02A), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about YWHAB monoclonal antibody (M02A), clone 1F11

Brand: Abnova
Reference: H00007529-M02A
Product name: YWHAB monoclonal antibody (M02A), clone 1F11
Product description: Mouse monoclonal antibody raised against a full-length recombinant YWHAB.
Clone: 1F11
Isotype: IgM Kappa
Gene id: 7529
Gene name: YWHAB
Gene alias: GW128|HS1|KCIP-1
Gene description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
Genbank accession: BC001359
Immunogen: YWHAB (AAH01359, 1 a.a. ~ 246 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEERQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Protein accession: AAH01359
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007529-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.8 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YWHAB monoclonal antibody (M02A), clone 1F11 now

Add to cart