YY1 monoclonal antibody (M05), clone 4C1 View larger

YY1 monoclonal antibody (M05), clone 4C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YY1 monoclonal antibody (M05), clone 4C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about YY1 monoclonal antibody (M05), clone 4C1

Brand: Abnova
Reference: H00007528-M05
Product name: YY1 monoclonal antibody (M05), clone 4C1
Product description: Mouse monoclonal antibody raised against a partial recombinant YY1.
Clone: 4C1
Isotype: IgG1 Kappa
Gene id: 7528
Gene name: YY1
Gene alias: DELTA|INO80S|NF-E1|UCRBP|YIN-YANG-1
Gene description: YY1 transcription factor
Genbank accession: NM_003403
Immunogen: YY1 (NP_003394, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Protein accession: NP_003394
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007528-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007528-M05-1-25-1.jpg
Application image note: YY1 monoclonal antibody (M05), clone 4C1 Western Blot analysis of YY1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YY1 monoclonal antibody (M05), clone 4C1 now

Add to cart