YES1 monoclonal antibody (M02A), clone 3C6 View larger

YES1 monoclonal antibody (M02A), clone 3C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YES1 monoclonal antibody (M02A), clone 3C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about YES1 monoclonal antibody (M02A), clone 3C6

Brand: Abnova
Reference: H00007525-M02A
Product name: YES1 monoclonal antibody (M02A), clone 3C6
Product description: Mouse monoclonal antibody raised against a partial recombinant YES1.
Clone: 3C6
Isotype: IgG2b Kappa
Gene id: 7525
Gene name: YES1
Gene alias: HsT441|P61-YES|Yes|c-yes
Gene description: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
Genbank accession: BC048960
Immunogen: YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
Protein accession: AAH48960
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007525-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007525-M02A-1-6-1.jpg
Application image note: YES1 monoclonal antibody (M02A), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy YES1 monoclonal antibody (M02A), clone 3C6 now

Add to cart