Brand: | Abnova |
Reference: | H00007525-M02 |
Product name: | YES1 monoclonal antibody (M02), clone 3C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant YES1. |
Clone: | 3C6 |
Isotype: | IgG2b kappa |
Gene id: | 7525 |
Gene name: | YES1 |
Gene alias: | HsT441|P61-YES|Yes|c-yes |
Gene description: | v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 |
Genbank accession: | BC048960 |
Immunogen: | YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV |
Protein accession: | AAH48960 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | YES1 monoclonal antibody (M02), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |