XRCC3 monoclonal antibody (M02), clone 1H7 View larger

XRCC3 monoclonal antibody (M02), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of XRCC3 monoclonal antibody (M02), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about XRCC3 monoclonal antibody (M02), clone 1H7

Brand: Abnova
Reference: H00007517-M02
Product name: XRCC3 monoclonal antibody (M02), clone 1H7
Product description: Mouse monoclonal antibody raised against a partial recombinant XRCC3.
Clone: 1H7
Isotype: IgG2a Kappa
Gene id: 7517
Gene name: XRCC3
Gene alias: -
Gene description: X-ray repair complementing defective repair in Chinese hamster cells 3
Genbank accession: BC011725
Immunogen: XRCC3 (AAH11725, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH
Protein accession: AAH11725
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007517-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged XRCC3 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy XRCC3 monoclonal antibody (M02), clone 1H7 now

Add to cart