Brand: | Abnova |
Reference: | H00007494-M05 |
Product name: | XBP1 monoclonal antibody (M05), clone 2D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant XBP1. |
Clone: | 2D9 |
Isotype: | IgG2a Kappa |
Gene id: | 7494 |
Gene name: | XBP1 |
Gene alias: | TREB5|XBP2 |
Gene description: | X-box binding protein 1 |
Genbank accession: | BC012841 |
Immunogen: | XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP |
Protein accession: | AAH12841 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | XBP1 monoclonal antibody (M05), clone 2D9. Western Blot analysis of XBP1 expression in human stomach. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |