XBP1 monoclonal antibody (M04), clone 4E4 View larger

XBP1 monoclonal antibody (M04), clone 4E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of XBP1 monoclonal antibody (M04), clone 4E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about XBP1 monoclonal antibody (M04), clone 4E4

Brand: Abnova
Reference: H00007494-M04
Product name: XBP1 monoclonal antibody (M04), clone 4E4
Product description: Mouse monoclonal antibody raised against a partial recombinant XBP1.
Clone: 4E4
Isotype: IgG2a Kappa
Gene id: 7494
Gene name: XBP1
Gene alias: TREB5|XBP2
Gene description: X-box binding protein 1
Genbank accession: BC012841
Immunogen: XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP
Protein accession: AAH12841
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007494-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007494-M04-1-23-1.jpg
Application image note: XBP1 monoclonal antibody (M04), clone 4E4 Western Blot analysis of XBP1 expression in U-2 OS( Cat # L022V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy XBP1 monoclonal antibody (M04), clone 4E4 now

Add to cart