Brand: | Abnova |
Reference: | H00007490-M04 |
Product name: | WT1 monoclonal antibody (M04), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant WT1. |
Clone: | 1E2 |
Isotype: | IgG2a Kappa |
Gene id: | 7490 |
Gene name: | WT1 |
Gene alias: | GUD|WAGR|WIT-2|WT33 |
Gene description: | Wilms tumor 1 |
Genbank accession: | NM_000378 |
Immunogen: | WT1 (NP_000369.3, 349 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC |
Protein accession: | NP_000369.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |