WT1 monoclonal antibody (M03), clone 1A12 View larger

WT1 monoclonal antibody (M03), clone 1A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WT1 monoclonal antibody (M03), clone 1A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about WT1 monoclonal antibody (M03), clone 1A12

Brand: Abnova
Reference: H00007490-M03
Product name: WT1 monoclonal antibody (M03), clone 1A12
Product description: Mouse monoclonal antibody raised against a full length recombinant WT1.
Clone: 1A12
Isotype: IgG2b Kappa
Gene id: 7490
Gene name: WT1
Gene alias: GUD|WAGR|WIT-2|WT33
Gene description: Wilms tumor 1
Genbank accession: NM_000378
Immunogen: WT1 (NP_000369.3, 349 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
Protein accession: NP_000369.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007490-M03-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to WT1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy WT1 monoclonal antibody (M03), clone 1A12 now

Add to cart