WT1 monoclonal antibody (M01), clone 2H4 View larger

WT1 monoclonal antibody (M01), clone 2H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WT1 monoclonal antibody (M01), clone 2H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about WT1 monoclonal antibody (M01), clone 2H4

Brand: Abnova
Reference: H00007490-M01
Product name: WT1 monoclonal antibody (M01), clone 2H4
Product description: Mouse monoclonal antibody raised against a full length recombinant WT1.
Clone: 2H4
Isotype: IgG2b Kappa
Gene id: 7490
Gene name: WT1
Gene alias: GUD|WAGR|WIT-2|WT33
Gene description: Wilms tumor 1
Genbank accession: NM_000378
Immunogen: WT1 (NP_000369.3, 349 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
Protein accession: NP_000369.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007490-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007490-M01-1-4-1.jpg
Application image note: WT1 monoclonal antibody (M01), clone 2H4 Western Blot analysis of WT1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy WT1 monoclonal antibody (M01), clone 2H4 now

Add to cart