View larger

WRN (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of WRN (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00007486-Q01
Product name:	WRN (Human) Recombinant Protein (Q01)
Product description:	Human WRN partial ORF ( NP_000544, 1322 a.a. - 1432 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	7486
Gene name:	WRN
Gene alias:	DKFZp686C2056\|RECQ3\|RECQL2\|RECQL3
Gene description:	Werner syndrome
Genbank accession:	NM_000553
Immunogen sequence/protein sequence:	NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Protein accession:	NP_000544
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	WRN protein as a novel erythroblast immunohistochemical marker with applications for the diagnosis of Werner syndrome.Sadahira Y, Sugihara T, Fujiwara H, Nishimura H, Suetsugu Y, Takeshita M, Okamura S, Goto M. Virchows Arch. 2015 Mar;466(3):343-50.