WRN monoclonal antibody (M09), clone 3C11 View larger

WRN monoclonal antibody (M09), clone 3C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WRN monoclonal antibody (M09), clone 3C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about WRN monoclonal antibody (M09), clone 3C11

Brand: Abnova
Reference: H00007486-M09
Product name: WRN monoclonal antibody (M09), clone 3C11
Product description: Mouse monoclonal antibody raised against a partial recombinant WRN.
Clone: 3C11
Isotype: IgG2a Kappa
Gene id: 7486
Gene name: WRN
Gene alias: DKFZp686C2056|RECQ3|RECQL2|RECQL3
Gene description: Werner syndrome
Genbank accession: NM_000553
Immunogen: WRN (NP_000544, 1322 a.a. ~ 1432 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Protein accession: NP_000544
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007486-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007486-M09-1-25-1.jpg
Application image note: WRN monoclonal antibody (M09), clone 3C11 Western Blot analysis of WRN expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy WRN monoclonal antibody (M09), clone 3C11 now

Add to cart