WRB monoclonal antibody (M04), clone 2A3 View larger

WRB monoclonal antibody (M04), clone 2A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WRB monoclonal antibody (M04), clone 2A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about WRB monoclonal antibody (M04), clone 2A3

Brand: Abnova
Reference: H00007485-M04
Product name: WRB monoclonal antibody (M04), clone 2A3
Product description: Mouse monoclonal antibody raised against a partial recombinant WRB.
Clone: 2A3
Isotype: IgG2a Kappa
Gene id: 7485
Gene name: WRB
Gene alias: CHD5
Gene description: tryptophan rich basic protein
Genbank accession: NM_004627
Immunogen: WRB (NP_004618, 29 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Protein accession: NP_004618
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007485-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007485-M04-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged WRB is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy WRB monoclonal antibody (M04), clone 2A3 now

Add to cart