Brand: | Abnova |
Reference: | H00007474-M04 |
Product name: | WNT5A monoclonal antibody (M04), clone 3A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WNT5A. |
Clone: | 3A4 |
Isotype: | IgG2a Kappa |
Gene id: | 7474 |
Gene name: | WNT5A |
Gene alias: | hWNT5A |
Gene description: | wingless-type MMTV integration site family, member 5A |
Genbank accession: | BC064694 |
Immunogen: | WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV |
Protein accession: | AAH64694 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | WNT5A has Anti-Prostate Cancer Effects In Vitro and Reduces Tumor Growth in the Skeleton In Vivo.Thiele S, Gobel A, Rachner TD, Fuessel S, Froehner M, Muders MH, Baretton GB, Bernhardt R, Jakob F, Gluer CC, Bornhauser M, Rauner M, Hofbauer LC J Bone Miner Res. 2014 Sep 15. doi: 10.1002/jbmr.2362. |