WNT5A monoclonal antibody (M04), clone 3A4 View larger

WNT5A monoclonal antibody (M04), clone 3A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WNT5A monoclonal antibody (M04), clone 3A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA

More info about WNT5A monoclonal antibody (M04), clone 3A4

Brand: Abnova
Reference: H00007474-M04
Product name: WNT5A monoclonal antibody (M04), clone 3A4
Product description: Mouse monoclonal antibody raised against a partial recombinant WNT5A.
Clone: 3A4
Isotype: IgG2a Kappa
Gene id: 7474
Gene name: WNT5A
Gene alias: hWNT5A
Gene description: wingless-type MMTV integration site family, member 5A
Genbank accession: BC064694
Immunogen: WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
Protein accession: AAH64694
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007474-M04-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: WNT5A has Anti-Prostate Cancer Effects In Vitro and Reduces Tumor Growth in the Skeleton In Vivo.Thiele S, Gobel A, Rachner TD, Fuessel S, Froehner M, Muders MH, Baretton GB, Bernhardt R, Jakob F, Gluer CC, Bornhauser M, Rauner M, Hofbauer LC
J Bone Miner Res. 2014 Sep 15. doi: 10.1002/jbmr.2362.

Reviews

Buy WNT5A monoclonal antibody (M04), clone 3A4 now

Add to cart