WEE1 monoclonal antibody (M01A), clone 5B6 View larger

WEE1 monoclonal antibody (M01A), clone 5B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WEE1 monoclonal antibody (M01A), clone 5B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about WEE1 monoclonal antibody (M01A), clone 5B6

Brand: Abnova
Reference: H00007465-M01A
Product name: WEE1 monoclonal antibody (M01A), clone 5B6
Product description: Mouse monoclonal antibody raised against a partial recombinant WEE1.
Clone: 5B6
Isotype: IgM Kappa
Gene id: 7465
Gene name: WEE1
Gene alias: DKFZp686I18166|FLJ16446|WEE1A|WEE1hu
Gene description: WEE1 homolog (S. pombe)
Genbank accession: NM_003390
Immunogen: WEE1 (NP_003381, 289 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAI
Protein accession: NP_003381
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007465-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00007465-M01A-1-25-1.jpg
Application image note: WEE1 monoclonal antibody (M01A), clone 5B6 Western Blot analysis of WEE1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Proteasome Inhibition Contributed to the Cytotoxicity of Arenobufagin after Its Binding with Na, K-ATPase in Human Cervical Carcinoma HeLa Cells.Yue Q, Zhen H, Huang M, Zheng X, Feng L, Jiang B, Yang M, Wu W, Liu X, Guo D.
PLoS One. 2016 Jul 18;11(7):e0159034.

Reviews

Buy WEE1 monoclonal antibody (M01A), clone 5B6 now

Add to cart