Brand: | Abnova |
Reference: | H00007465-M01A |
Product name: | WEE1 monoclonal antibody (M01A), clone 5B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WEE1. |
Clone: | 5B6 |
Isotype: | IgM Kappa |
Gene id: | 7465 |
Gene name: | WEE1 |
Gene alias: | DKFZp686I18166|FLJ16446|WEE1A|WEE1hu |
Gene description: | WEE1 homolog (S. pombe) |
Genbank accession: | NM_003390 |
Immunogen: | WEE1 (NP_003381, 289 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAI |
Protein accession: | NP_003381 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | WEE1 monoclonal antibody (M01A), clone 5B6 Western Blot analysis of WEE1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Proteasome Inhibition Contributed to the Cytotoxicity of Arenobufagin after Its Binding with Na, K-ATPase in Human Cervical Carcinoma HeLa Cells.Yue Q, Zhen H, Huang M, Zheng X, Feng L, Jiang B, Yang M, Wu W, Liu X, Guo D. PLoS One. 2016 Jul 18;11(7):e0159034. |