Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007461-M07 |
Product name: | CLIP2 monoclonal antibody (M07), clone 3H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CLIP2. |
Clone: | 3H5 |
Isotype: | IgG2a Kappa |
Gene id: | 7461 |
Gene name: | CLIP2 |
Gene alias: | CLIP|CLIP-115|CYLN2|KIAA0291|MGC11333|WBSCR3|WBSCR4|WSCR3|WSCR4 |
Gene description: | CAP-GLY domain containing linker protein 2 |
Genbank accession: | NM_003388 |
Immunogen: | CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH |
Protein accession: | NP_003379 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CLIP2 expression in transfected 293T cell line by CLIP2 monoclonal antibody (M07), clone 3H5. Lane 1: CLIP2 transfected lysate (Predicted MW: 115.06 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |