CLIP2 monoclonal antibody (M07), clone 3H5 View larger

CLIP2 monoclonal antibody (M07), clone 3H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLIP2 monoclonal antibody (M07), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about CLIP2 monoclonal antibody (M07), clone 3H5

Brand: Abnova
Reference: H00007461-M07
Product name: CLIP2 monoclonal antibody (M07), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant CLIP2.
Clone: 3H5
Isotype: IgG2a Kappa
Gene id: 7461
Gene name: CLIP2
Gene alias: CLIP|CLIP-115|CYLN2|KIAA0291|MGC11333|WBSCR3|WBSCR4|WSCR3|WSCR4
Gene description: CAP-GLY domain containing linker protein 2
Genbank accession: NM_003388
Immunogen: CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
Protein accession: NP_003379
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007461-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007461-M07-13-15-1.jpg
Application image note: Western Blot analysis of CLIP2 expression in transfected 293T cell line by CLIP2 monoclonal antibody (M07), clone 3H5.

Lane 1: CLIP2 transfected lysate (Predicted MW: 115.06 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLIP2 monoclonal antibody (M07), clone 3H5 now

Add to cart